Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

2,041 – 2,055 of 115,704 results

2,041

Novus Biologicals™ Recombinant Mouse CD14 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CD14 antigen, CD14 molecule, monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein
Common Name	CD14
Molecular Weight (g/mol)	TMW: 38.3kDa
Gene ID (Entrez)	929
Formulation	Phosphate buffered saline (pH 7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Recombinant	Recombinant

2,042

Novus Biologicals™ CBP20 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	CBP20
Molecular Weight (g/mol)	20.1kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Recombinant human NCBP2 protein, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	NP_031388
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	22916
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
Immunogen	NCBP2, 1-156aa, Human, His tag, E. coli (NP_031388).
Recombinant	Recombinant

2,043

R&D Systems™ Recombinant Human TRAIL R2 Fc Alexa Fluor™ 488 Protein

Recombinant Protein

Pricing & Availability

2,044

Novus Biologicals™ PHPT1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PHPT1
Molecular Weight (g/mol)	15.9kDa
Gene ID (Entrez)	29085
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Immunogen	PHPT1, 1-125 aa. MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

2,045

Gibco™ Mouse IGF-I Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>98% by SDS-PAGE
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	7.6 kDa
Common Name	IGF1
Gene Symbol	IGF1
Activity	ED50 ≤ 2 ng/mL; determined by the dose-dependent proliferation of FDC-P1 cells.
Endotoxin Concentration	<0.1 ng/μg
Storage Requirements	-20°C
Sequence	GPETLCGAEL VDALQFVCGP RGFYFNKPTG YGSSIRRAPQ TGIVDECCFR SCDLRRLEMY CAPLKPTKAA
Expression System	E. coli
For Use With (Application)	Bioactivity
Name	Mouse IGF-I
Accession Number	P05017
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	C730016P09Rik; class 1 insulin-like growth factor I preproprotein; class 2 insulin-like growth factor I preproprotein; H-IGF-1; IBP1; IGF; IGF1; Igf-1; IGF1A; IGFI; Igf-I; IGFIa; IGF-IA; IGF-IB; insulin growth factor-1; Insulin like growth factor; insulin like growth factor 1; insulin-like growth factor 1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor I; insulin-like growth factor I (somatomedin C); insulin-like growth factor IB; mechano growth factor; MGF; M-IGF-1; OTTHUMP00000195084; prepro-IGF-I; prepro-insulin-like growth factor I; R-IGF-1; somatomedin; Somatomedin C; Somatomedin-C
Product Type	Protein
Gene ID (Entrez)	16000
Formulation	Protein with no preservative
Recombinant	Recombinant

2,046

R&D Systems™ Recombinant Human IFN-alpha-4A Protein

Pricing & Availability
Specifications

Accession Number	P05014.2
Purity or Quality Grade	>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate	Unconjugated
Gene Alias	IFNA4, IFNalpha 4, IFN-alpha-4, IFN-alpha4a, INFA4, interferon alpha-4, Interferon alpha-4 B, Interferon alpha-76, Interferon alpha-M1, interferon, alpha 4, MGC142200
Molecular Weight (g/mol)	MolecularWeight-observed: 17-23 kDa, under reducing conditions., MolecularWeight-theroretical: 19 kDa
Gene ID (Entrez)	3441
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS.
Reconstitution	Reconstitute at 100 μg/mL in PBS.
Endotoxin Concentration	<0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	IFN-alpha 4
Source	Human embryonic kidney cell, HEK293-derived human IFN-alpha 4 protein Cys24-Asp189

2,047

Novus Biologicals™ Recombinant Mouse Histone Deacetylase 8/HDAC8 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	42.5 kDa
Gene Symbol	HDAC8
Endotoxin Concentration	< 1.0 EU per 1 microgram of protein (determined by LAL method)
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Name	Recombinant Human Histone Deacetylase 8/HDAC8 Protein
Regulatory Status	RUO
Purification Method	>90%, by SDS-PAGE
Gene Alias	EC 3.5.1.98, HD8, HDACL1, histone deacetylase 8, histone deacetylase-like 1, RPD3
Product Type	Recombinant Protein
Gene ID (Entrez)	55869
Formulation	Liquid. PBS (pH 7.4) containing 10% glycerol
Cross Reactivity	Human
Recombinant	Recombinant

2,048

R&D Systems™ Goat Keratan Sulfate Proteoglycans Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,049

R&D Systems™ Recombinant Human CD79B Protein

R&D Systems™ Recombinant Human CD79B Protein CF is a member of the Ig superfamily.

Pricing & Availability

2,050

R&D Systems™ Recombinant Mouse ASIP/Agouti Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,051

R&D Systems™ Recombinant SARS-CoV-2 C.37 S (GCN4-IZ) Avi His Protein

Avi-tag His-tag Lambda Variant

Pricing & Availability

2,052

R&D Systems™ Recombinant Human CA125/MUC16 Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

2,053

R&D Systems™ Recombinant Viral HCV E2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.